PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 241aa    MW: 27588.3 Da    PI: 7.1965
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30385.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH42.21.5e-1362114155
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                 ++ +hn+ Er RR+++N+  + Lr+llP a   + kK+s  +++ ++++YI +Lq
  KHN30385.1  62 KKLSHNASERDRRKKVNHLVSSLRSLLPVA--DQTKKMSIPTTVSRVIKYIPELQ 114
                 6789*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.2461113IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.51E-1162118No hitNo description
PfamPF000107.2E-1162114IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.44E-1562132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.6E-1262105IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.0E-1067119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:3.40.50.1502.0E-4106220IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVALFSPPVF STKGWLLEED PLSYDVSSEY SFPYQFYSPQ TQIELEIERS TSPSPEDPAM  60
VKKLSHNASE RDRRKKVNHL VSSLRSLLPV ADQTKKMSIP TTVSRVIKYI PELQQQVEAL  120
SKKKEDLLCR ISRQLQGDAV NKDSQRRISH HNSDFVVSTS RLNDCEAVVH ISSYEAHKAP  180
LSEILQCLEN NGLLLLNASS SETFGGRVFY NLHFQVEKTQ RLESEILTEK LLSIYEKQRI  240
F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311010.0KT031101.1 Glycine max clone HN_CCL_45 bHLH transcription factor (Glyma03g28630.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520500.11e-178PREDICTED: transcription factor ORG2-like
TrEMBLA0A0B2RA031e-178A0A0B2RA03_GLYSO; Transcription factor ORG2
TrEMBLK7KEQ91e-178K7KEQ9_SOYBN; Uncharacterized protein
STRINGGLYMA03G28611.11e-177(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.19e-49bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]